Invitrogen™ Human Lyn (aa 7-147) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95925	100 μL

Catalog No. RP95925 Supplier Invitrogen™ Supplier No. RP95925

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81925. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).

Specifications

• Accession Number: P07948
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4067
• Name: Human Lyn (aa 7-147) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA407514; CD180; CD180 antigen; CD180 molecule; CH73-38P6.3; FLJ26625; Hck-2; JTK8; lck/Yes-related novel protein tyrosine kinase; LY64; Ly78; lymphocyte antigen 64; lymphocyte antigen-64, radioprotective, 105kDa; LYN; lyn protein non-receptor kinase; lyn protein tyrosine kinase; LYN proto-oncogene, Src family tyrosine kinase; p53Lyn; p56Lyn; Radioprotective 105 kDa protein; RP105; Tyrosine-protein kinase Lyn; v-yes-1 Yamaguchi sarcoma viral related oncogene homolog; v-yes-1 Yamaguchi sarcoma viral related oncogene protein-like protein; Yamaguchi sarcoma viral (v-yes-1) oncogene homolog; zgc:92124
• Common Name: Lyn
• Gene Symbol: LYN
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining