Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human LYPD3 (aa 42-129) Control Fragment Recombinant Protein

Catalog No. RP99019
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99019 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99019 Supplier Invitrogen™ Supplier No. RP99019
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lymphocyte antigen 6 family member D3 (LYPD3), also known as C4.4A, is a gene located on chromosome 19q13.11 that encodes a glycosylphosphatidylinositol (GPI)-anchored protein belonging to the Ly6/uPAR superfamily. LYPD3 is expressed in various epithelial tissues and is implicated in cellular adhesion and migration processes. The protein plays a significant role in tumor progression and metastasis, with its expression being notably upregulated in several cancers, including squamous cell carcinoma and lung cancer. LYPD3 contributes to the invasive behavior of cancer cells by interacting with matrix components and modulating signaling pathways related to cell motility and adhesion. Its involvement in cancer biology makes LYPD3 a potential biomarker for tumor aggressiveness and a target for therapeutic intervention aimed at inhibiting cancer cell dissemination. Research continues to explore its functional mechanisms in oncogenesis and potential applications in cancer treatment strategies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95274
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 27076
Name Human LYPD3 (aa 42-129) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2310061G07Rik; C4.4A; GPI-anchored metastasis-associated protein C4.4A homolog; GPI-anchored metastasis-associated protein homolog; LY6/PLAUR domain containing 3; ly6/PLAUR domain-containing protein 3; LYPD3; Matrigel-induced gene C4 protein; MIG-C4; UNQ491/PRO1007
Common Name LYPD3
Gene Symbol LYPD3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.