Invitrogen™ Human LYVE1 (aa 82-231) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102930	100 μL

Catalog No. RP102930 Supplier Invitrogen™ Supplier No. RP102930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111168. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LYVE1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module, the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves. LYVE1 is a type I integral membrane glycoprotein. LYVE-1 is expressed primarily on lymphatic vessel endothelium and is likely to be involved in regulating the traffic of leucocytes and tumor cells to lymph nodes. The lymphatic vasculature forms a second circulatory system that drains extracellular fluid from the tissues and provides an exclusive environment in which immune cells can encounter and respond to foreign antigen. A number of molecules have been identified as markers for lymphatic endothelium which include LYVE1, PALE, VEGFR3, and podoplanin. Diseases associated with LYVE1 dysfunction includes Complete Androgen Insensitivity Syndrome.

Specifications

• Accession Number: Q9Y5Y7
• Concentration: 2 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10894
• Name: Human LYVE1 (aa 82-231) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200012G08Rik; cell surface retention sequence binding protein-1; cell surface retention sequence-binding protein 1; CRSBP1; CRSBP-1; extra cellular link domain-containing 1; extracellular link domain containing 1; extracellular link domain-containing 1; extracellular link domain-containing protein 1; HAR; hyaluronic acid receptor; lymphatic endothelial hyaluronan receptor LYVE-1; lymphatic vessel endothelial HA receptor-1; lymphatic vessel endothelial HA recptor-1; lymphatic vessel endothelial hyaluronan receptor 1; lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE1; LYVE-1; sLyve 1; sLyve1; soluble LYVE 1; soluble LYVE1; UNQ230/PRO263; XLKD1
• Common Name: LYVE1
• Gene Symbol: Lyve1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining