Invitrogen™ Human LZTFL1 (aa 75-151) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100204	100 μL

Catalog No. RP100204 Supplier Invitrogen™ Supplier No. RP100204

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZTFL1, also known as Leucine Zipper Transcription Factor-Like 1, is situated on the chromosomal region 3p21.3, which is frequently deleted in various cancers, including kidney cancer. It acts as a tumor suppressor by destabilizing AKT, a key protein in cell growth pathways, thus inhibiting tumor cell growth. Additionally, LZTFL1 has been implicated in the epithelial-mesenchymal transition in COVID-19, suggesting a role in viral response pathways. It is associated with Bardet-Biedl syndrome (BBS) and interacts with IFT27, a regulator of sperm flagellum formation, affecting spermatogenesis and male fertility. Knockout models show a phenotype of obesity, retinal degeneration, and abnormal cilia development, highlighting its role in normal ciliary function. The gene has two transcript isoforms and is part of a transcriptional map covering 250 kb, making it a subject of extensive genetic research.

Specifications

• Accession Number: Q9NQ48
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54585
• Name: Human LZTFL1 (aa 75-151) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5530402H04Rik; 6130400H19Rik; AI414725; AW048545; BBS17; fb53f12; leucine zipper transcription factor like 1; leucine zipper transcription factor-like 1; leucine zipper transcription factor-like protein 1; LZTFL1; wu:fb53f12; zgc:56268
• Common Name: LZTFL1
• Gene Symbol: Lztfl1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining