Invitrogen™ Human LZTR1 (aa 180-259) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104039	100 μL

Catalog No. RP104039 Supplier Invitrogen™ Supplier No. RP104039

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64381. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZTR1, a member of the BTB-kelch superfamily, was initially described as a putative transcriptional regulator based on weak homology to members of the basic leucine zipper-like family, the encoded protein subsequently has been shown to localize exclusively to the Golgi network where it may help stabilize the Golgi complex. Deletion of this gene may be associated with DiGeorge syndrome, a developmental field defect involving the third and fourth pharyngeal pouches, causing the absence of thymus and parathyroid glands, congenital cardiac abnormalities and facial dysmorphism. LZTR1 is tyrosine phosphorylated and subsequently degraded upon induction of apoptosis.

Specifications

• Accession Number: Q8N653
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8216
• Name: Human LZTR1 (aa 180-259) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200003E21Rik; AI591627; AW550890; BTBD29; fj87c05; leucine zipper like transcription regulator 1; leucine-zipper-like transcription regulator 1; leucine-zipper-like transcriptional regulator 1; leucine-zipper-like transcriptional regulator, 1; Lztr1; LZTR-1; MGC21205; NS10; si:dkey-98f17.2; SWNTS2; Tcfl2; wu:fj87c05; zgc:158250
• Common Name: LZTR1
• Gene Symbol: LZTR1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining