Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human LZTR2 (aa 109-182) Control Fragment Recombinant Protein

Catalog No. RP104994
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104994 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104994 Supplier Invitrogen™ Supplier No. RP104994
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZTR2, also known as RGPR-p117, is a member of the BTB-kelch superfamily and was initially described as a nuclear factor I (NFI) binding protein and transcriptional regulator of the regucalcin gene. LZTR2 is cytoplasmically localized but is thought to translocate to the nucleus, a process mediated by protein kinase C signaling following hormonal stimulation. Recent evidence has suggested that there is a strong correlation of single nucleotide polymorphisms of LZTR2 with obesity in the Japanese population similar to that seen with the TMEM18 gene and the GNPDA2, BDNF, FAIM2, and MC4R genes with obesity in Caucasian populations, suggesting LZTR2 may play a role in metabolism and obesity risk.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96JE7
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 89866
Name Human LZTR2 (aa 109-182) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias KIAA1928; Leucine zipper transcription regulator 2; LZTR2; PGPR-p117; protein SEC16 homolog B; protein transport protein Sec16B; Regucalcin gene promoter region-related protein p117; regucalcin gene promotor region related protein; RGPR; Rgpr-p117; SEC16 homolog B; SEC16 homolog B (S. cerevisiae); SEC16 homolog B, endoplasmic reticulum export factor; Sec16b; SEC16S
Common Name LZTR2
Gene Symbol SEC16B
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.