Invitrogen™ Human MAGEA4 (aa 81-209) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92236	100 μL

Catalog No. RP92236 Supplier Invitrogen™ Supplier No. RP92236

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82782. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAGEA4 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Specifications

• Accession Number: P43358
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4103
• Name: Human MAGEA4 (aa 81-209) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cancer/testis antigen 1.4; cancer/testis antigen family 1, member 4; CT1.4; MAGE family member A4; MAGE4; MAGE-4 antigen; MAGE-41; MAGE-41 antigen; MAGE4A; MAGE4B; MAGEA4; Mage-a4; MAGE-X2; MAGE-X2 antigen; melanoma antigen family A, 4; melanoma antigen family A4; melanoma antigen, family A, 4; melanoma-associated antigen 4; MGC21336
• Common Name: MAGEA4
• Gene Symbol: MAGEA4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining