Invitrogen™ Human MAGED1 (aa 72-221) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104776	100 μL

Catalog No. RP104776 Supplier Invitrogen™ Supplier No. RP104776

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65365. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Accession Number: Q9Y5V3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9500
• Name: Human MAGED1 (aa 72-221) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 11B6; 2810433C11Rik; 5430405L04Rik; BCG-1; Dlixin; Dlxin1; DLXIN-1; DXBwg1492e; JCL-1; MAGE family member D1; MAGE tumor antigen CCF; MAGED1; MAGE-D1; MAGE-D1 antigen; Maged2; melanoma antigen family D, 1; melanoma antigen family D1; melanoma antigen, family D, 1; melanoma-associated antigen D1; mFLJ00163; neurotrophin receptor-interacting MAGE homolog; NRAGE; PP2250; PRO2292; Sertoli cell necdin-related gene protein 1; SNERG-1
• Common Name: MAGED1
• Gene Symbol: MAGED1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQADIETDPGISEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining