Invitrogen™ Human MAGI1 (aa 1067-1150) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95128	100 μL

Catalog No. RP95128 Supplier Invitrogen™ Supplier No. RP95128

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Accession Number: Q96QZ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9223
• Name: Human MAGI1 (aa 1067-1150) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AIP3; AIP-3; Atrophin-1-interacting protein 3; BAI1-associated protein 1; Baiap1; BAP1; BAP-1; Gukmi1; MAGI1; Magi-1; MAGI1c; Magi1d; membrane associated guanylate kinase, WW and PDZ domain containing 1; membrane-associated guanylate kinase inverted 1; Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; mKIAA4129; TNRC19; Trinucleotide repeat-containing gene 19 protein; WW domain-containing protein 3; WWP3
• Common Name: MAGI1
• Gene Symbol: Magi1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining