Invitrogen™ Human MAN1A2 (aa 125-180) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95731	100 μL

Catalog No. RP95731 Supplier Invitrogen™ Supplier No. RP95731

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56974. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.

Specifications

• Accession Number: O60476
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10905
• Name: Human MAN1A2 (aa 125-180) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3.2.1.113; AI428775; AI528764; AI854422; alpha1,2-mannosidase; Alpha-1,2-mannosidase IB; Man1a2; MAN1B; mannosidase 1, beta; mannosidase alpha class 1A member 2; mannosidase, alpha, class 1A, member 2; mannosyl-oligosaccharide 1,2-alpha-mannosidase IB; PCR2; Processing alpha-1,2-mannosidase IB
• Common Name: MAN1A2
• Gene Symbol: MAN1A2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining