Invitrogen™ Human MAP2 (aa 1540-1674) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89887	100 μL

Catalog No. RP89887 Supplier Invitrogen™ Supplier No. RP89887

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP2 (Microtubule Associated Protein 2) exists in two high molecular weight forms (MAP2a & MAP2b) and a low molecular weight form. The expression of MAP2 is developmentally regulated and its multiple forms arise by alternative splicing of a single gene. MAP2 is involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dendrites, implicating a role in determining and stabilizing dendritic shape during neuron development. MAP2 is useful in studies of neuron structure in normal and malignant brain tissue as well as in degenerative diseases such as Alzheimer's Disease (AD).

Specifications

• Accession Number: P11137
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4133
• Name: Human MAP2 (aa 1540-1674) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: a730034c02; AC091465.1; DKFZp686I2148; G1-397-34; MAP 2; Map2; MAP-2; map2.S; map2a; map-2a; map2ab; MAP2B; MAP2C; MAP2R; microtubule associated protein 2; microtubule associated protein 2 S homeolog; microtubule associated protein 2; microtubule-associated protein 2; microtubule associated protein 2C; microtubule-associated protein 2; microtubule-associated protein-2; Mtap2; Mtap-2; OTTHUMP00000163916; OTTHUMP00000208143; repro4; XELAEV_18047318mg; xmap2
• Common Name: MAP2
• Gene Symbol: Map2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining