Invitrogen™ Human MAP2K4 (aa 32-108) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105147	100 μL

Catalog No. RP105147 Supplier Invitrogen™ Supplier No. RP105147

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP2K4 (MEK4) serine/threonine kinase (mitogen-activated protein kinase 4) MEK4 or MKK4 is a dual specificity kinase of the STE7 family that phosphorylates and activates JNK1 and -2 as well as p38. MAP2K4 preferentially phosphorylates the tyrosine residue of JNKs. MAP2K4 mediates a variety of physiological and pathophysiological processes such as responses to cellular stresses and inflammatory cytokines. MAP2K4 is important for carcinogenesis; a loss-off-function mutation in MAP2K4 was found in lung and pancreatic tumors. Conversely, a pro-oncogenic role was also found for MAP2K4.

Specifications

• Accession Number: P45985
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6416
• Name: Human MAP2K4 (aa 32-108) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C-JUN N-terminal kinase kinase 1; dual specificity mitogen-activated protein kinase kinase 2; dual specificity mitogen-activated protein kinase kinase 4; dual specificity mitogen-activated protein kinase kinase 4; dual specificity mitogen-activated protein kinase kinase 4a; JNK kinase 1; JNK-activated kinase 1; JNK-activating kinase 1; JNKK; JNKK 1; JNKK1; MAP kinase activator 2; MAP kinase kinase 4; Map2k4; map2k4.L; map2k4a; map2k4-a; map2k4-b; MAP2K4delta; MAPK/ERK kinase 4; MAPKK 4; MAPKK4; MEK 4; MEK4; mitogen activated protein kinase kinase 4; mitogen activated protein kinase kinase 4, variant 1; mitogen-activated protein kinase kinase 4; mitogen-activated protein kinase kinase 4 L homeolog; mitogen-activated protein kinase kinase 4a; MKK4; mkk4a; MKK4A-l; PRKMK4; SAPK kinase 1; SAPK/ERK kinase 1; SAPK/Erk/kinase 1; SAPKK1; SAPKK-1; Sek1; Serk1; Skk1; Stress-activated protein kinase kinase 1; XELAEV_18044157mg; XMEK2; zgc:136500; zMKK4 protein
• Common Name: MAP2K4
• Gene Symbol: MAP2K4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining