Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97238

Invitrogen™ Human MAP4K5 (aa 401-482) Control Fragment Recombinant Protein

Catalog No. RP97238
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97238 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97238 Supplier Invitrogen™ Supplier No. RP97238
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP4K5 (KHS1) is a serine/threonine kinase that belongs to the GCK family of kinases and has been implicated as an upstream regulator of MAP kinase signaling pathways. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for MAP4K5.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y4K4
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 11183
Name Human MAP4K5 (aa 401-482) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4432415E19Rik; fl74c10; GCKR; germinal center kinase-related; KHS; KHS1; Kinase homologous to SPS1/STE20; LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase kinase 5; map4k5; MAPK/ERK kinase kinase kinase 5; MAPKKKK5; MEK kinase kinase 5; MEKKK 5; mitogen-activated protein kinase kinase kinase kinase 5; RGD1562028; wu:fl74c10; zgc:55719; zgc:55985
Common Name MAP4K5
Gene Symbol Map4k5
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPKPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.