Invitrogen™ Human MAPKAP1 (aa 372-521) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89608	100 μL

Catalog No. RP89608 Supplier Invitrogen™ Supplier No. RP89608

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sin1 was initially identified as the human homolog of S. pombe SIN1. Recent evidence has shown that it identical to Mip1, a protein that interacts with MEKK2, a member of the mitogen-activated protein kinase (MAPK) intracellular signaling network. MAPKAP1 is thought to prevent MEKK2 activation and dimerization by forming a complex with the inactive and non-phosphorylated MEKK2, thereby blocking the JNK1/2, ERK1/2, p38 and ERK5 MAPKs. MAPKAP1 has also been shown to play a role in the TOR signaling process, a pathway that is involved in controlling cell growth and proliferation in response to environmental cues such as nutrients, growth factors and hormones. Experiments showed that MAPKAP1 helped to maintain the TOR/rictor assembly but not the TOR/RAPTOR complex, which allowed specific phosphorylation of Akt, a kinase that is believed to couple the growth factor-PI3K signaling pathway to the nutrient-regulated TOR signaling pathway. Multiple alternatively spliced isoforms of MAPKAP1 have been identified.

Specifications

• Accession Number: Q9BPZ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 79109
• Name: Human MAPKAP1 (aa 372-521) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI591529; D230039K05Rik; im:7143088; JC310; MAPK associated protein 1; mapkap1; MEKK2-interacting protein 1; MGC2745; Mip1; MIP1SIN1SIN1b; mitogen activated protein kinase associated protein 1; mitogen-activated protein kinase 2-associated protein 1; mitogen-activated protein kinase associated protein 1; mSIN1; ras inhibitor MGC2745; RP11-269P11.1; SAPK interacting protein; SAPK-interacting protein 1; si:ch73-242f23.1; SIN1; SIN1b; SIN1g; stress-activated map kinase interacting protein 1; stress-activated map kinase-interacting protein 1; stress-activated protein kinase-interacting 1; target of rapamycin complex 2 subunit MAPKAP1; TORC2 subunit MAPKAP1
• Common Name: MAPKAP1
• Gene Symbol: MAPKAP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining