Invitrogen™ Human MAPKAPK2 (aa 362-398) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106093	100 μL

Catalog No. RP106093 Supplier Invitrogen™ Supplier No. RP106093

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-83779, PA5-111580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPKAPK2 mediates p38 and ERK signaling in vivo. It is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation, and cell proliferation. MAPKAPK2 encodes a member of the Ser/Thr protein kinase family. MAPKAPK2 is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, MAPKAPK2 is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for MAPKAPK2.

Specifications

• Accession Number: P49137
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9261
• Name: Human MAPKAPK2 (aa 362-398) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA960234; MAP kinase-activated protein kinase 2; MAPK activated protein kinase 2; MAPK-activated protein kinase 2; MAPKAP kinase 2; Mapkapk2; MAPKAP-K2; MAPKAPK-2; mitogen-activated protein kinase-activated protein kinase 2; MK2; MK-2; Rps6kc1
• Common Name: MAPKAPK2
• Gene Symbol: MAPKAPK2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining