Invitrogen™ Human MARK1 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89777	100 μL

Catalog No. RP89777 Supplier Invitrogen™ Supplier No. RP89777

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARK1 (MARK) is a serine/threonine kinase which is involved in cytoskeletal organization and biogenesis. Involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 is involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3).

Specifications

• Accession Number: Q9P0L2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4139
• Name: Human MARK1 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW491150; B930025N23Rik; ELKL motif serine/threonine-protein kinase 3; ELKL motif serine-threonine protein kinase 3; Emk3; KIAA1477; MAP/microtubule affinity regulating kinase 1; MAP/microtubule affinity-regulating kinase 1; MARK; MARK1; mark1 {ECO:0000312; microtubule affinity regulating kinase 1; mKIAA1477; mPar-1c; PAR1 homolog c; Par1c; Par-1c; RGD:619882}; serine/threonine-protein kinase MARK1
• Common Name: MARK1
• Gene Symbol: MARK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSYTKRPQANSVESEQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining