Invitrogen™ Human MBP (aa 216-301) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95730	100 μL

Catalog No. RP95730 Supplier Invitrogen™ Supplier No. RP95730

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.

Specifications

• Accession Number: P02686
• Concentration: 5.00 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4155
• Name: Human MBP (aa 216-301) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 20 kDa microtubule-stabilizing protein; C76307; golli mbp; Golli-mbp; Golli-MBP; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; Hmbpr; MBP; MBP S; Mbps; MGC99675; microtubule-stabilizing protein; mld; MOBP; Myelin A1 protein; myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; myelin membrane encephalitogenic protein; Myelin P1 protein; myelin-associated oligodendrocyte basic protein; R75289; shi; shiverer; Unknown (protein for IMAGE:7984318); unnamed protein product
• Common Name: MBP
• Gene Symbol: MBP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining