Invitrogen™ Human MED30 (aa 1-66) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106097	100 μL

Catalog No. RP106097 Supplier Invitrogen™ Supplier No. RP106097

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65417. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Med30 is a subunit of the RNA polymerase II (Pol II) transcriptional mediator complex. The mediator complex is a coactivator involved in the regulated transcription of Pol II-dependent genes. The mediator complex functions as a bridge to convey information from gene-specific regulatory proteins to the basal Pol II transcription machinery, and is recruited to promoter regions by directly interacting with regulatory proteins. The mediator complex also serves as a scaffold for the assembly of a functional pre-initiation complex with Pol II and other general transcription factors. Found in the nucleus, Med30 is expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.

Specifications

• Accession Number: Q96HR3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 90390
• Name: Human MED30 (aa 1-66) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810038N03Rik; 2510044J04Rik; Med30; MED30S; Mediator complex subunit 30; mediator of RNA polymerase II transcription subunit 30; putative mediator of RNA polymerase II transcription subunit 30; THRAP6; thyroid hormone receptor associated protein 6; thyroid hormone receptor-associated protein 6; Thyroid hormone receptor-associated protein complex 25 kDa component; TRAP/Mediator complex component TRAP25; TRAP25
• Common Name: MED30
• Gene Symbol: MED30
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining