Invitrogen™ Human MERTK (aa 149-220) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108055	100 μL

Catalog No. RP108055 Supplier Invitrogen™ Supplier No. RP108055

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MERTK (cMER) is a tyrosine kinase proto-oncogene and is involved in the retinal pigment epithelium (RPE) phagocytosis pathway, which is implicated in human retinal disease. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.

Specifications

• Accession Number: Q12866
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10461
• Name: Human MERTK (aa 149-220) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: c-Eyk; c-mer; c-mer proto-oncogene tyrosine kinase; Eyk; MER; MER proto-oncogene, tyrosine kinase; MER receptor tyrosine kinase; MERTK; MGC133349; nmf12; Nyk; Proto-oncogene c-Mer; proto-oncogene tyrosine-protein kinase MER; rdy; receptor tyrosine kinase MerTK; Receptor tyrosine tinase gene probably the gene for Rdy; retinal dystrophy; RP38; sMER; sMERTK; soluble MER; soluble MERTK; STK kinase; Tyro 12; Tyro12; Tyrosine-protein kinase Mer
• Common Name: MERTK
• Gene Symbol: Mertk
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining