Invitrogen™ Human MESDC1 (aa 301-362) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108587	100 μL

Catalog No. RP108587 Supplier Invitrogen™ Supplier No. RP108587

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84871. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Actin-binding protein which may have an oncogenic function and regulates cell proliferation, migration and invasion in cancer cells.

Specifications

• Accession Number: Q9H1K6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 59274
• Name: Human MESDC1 (aa 301-362) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW061151; MESDC1; Mesoderm development candidate 1; mesoderm development candidate 1; talin rod domain containing 1; talin rod domain containing 1; talin rod domain-containing protein 1; TLNRD1
• Common Name: MESDC1
• Gene Symbol: Tlnrd1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining