Invitrogen™ Human Mgea5 (aa 519-600) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108087	100 μL

Catalog No. RP108087 Supplier Invitrogen™ Supplier No. RP108087

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67426. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This protein forms homo- or hetero-dimers with other Ikaros family members, and is thought to function predominantly in early hematopoietic development. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Specifications

• Accession Number: O60502
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10724
• Name: Human Mgea5 (aa 519-600) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810009A20Rik; 4833427O07Rik; 5830447M11Rik; AA408215; beta-hexosaminidase; Beta-N-acetylglucosaminidase; beta-N-acetylhexosaminidase; Bifunctional protein NCOAT; Hexc; Hy5; hyaluronidase in meningioma; KIAA0679; MEA5; meningioma expressed antigen 5 (hyaluronidase); meningioma-expressed antigen 5; Mgea5; mKIAA0679; N-acetyl-beta-D-glucosaminidase; N-acetyl-beta-glucosaminidase; NCOAT; Nuclear cytoplasmic O-GlcNAcase and acetyltransferase; OGA; O-GLCNACASE; Protein O-GlcNAcase
• Common Name: Mgea5
• Gene Symbol: MGEA5, Oga
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining