Invitrogen™ Human MGST1 (aa 36-68) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100835	100 μL

Catalog No. RP100835 Supplier Invitrogen™ Supplier No. RP100835

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60845. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress.

Specifications

• Accession Number: P10620
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4257
• Name: Human MGST1 (aa 36-68) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1500002K10Rik; glutathione S-transferase; glutathione S-transferase 12; Gst; GST12; MGC14525; MGST; mGST1; MGST-I; Microsomal glutathione S-transferase 1; microsomal glutathione S-transferase 1-like protein; microsomal glutathione-S-transferase; microsomal GST-1; Microsomal GST-I
• Common Name: MGST1
• Gene Symbol: MGST1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining