Invitrogen™ Human MLX (aa 196-267) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103135	100 μL

Catalog No. RP103135 Supplier Invitrogen™ Supplier No. RP103135

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62677. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Specifications

• Accession Number: Q9UH92
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6945
• Name: Human MLX (aa 196-267) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: bHLHd13; BigMax alpha; BigMax protein; class D basic helix-loop-helix protein 13; hypothetical protein LOC508531; im:7146242; MAD7; MAX dimerization protein MLX; MAX-like bHLHZIP protein; max-like factor protein; max-like protein X; Mlx; MLX, MAX dimerization protein; MXD7; Protein BigMax; TCFL4; TF4; transcription factor like 4; transcription factor-like 4; transcription factor-like protein 4; wu:fb61a01; wu:fb99c01; zgc:112409
• Common Name: MLX
• Gene Symbol: Mlx
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining