Invitrogen™ Human MMS19 (aa 447-530) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106363	100 μL

Catalog No. RP106363 Supplier Invitrogen™ Supplier No. RP106363

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84093. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into apoproteins specifically involved in DNA metabolism and genomic integrity. In the CIA complex, MMS19 acts as an adapter between early-acting CIA components and a subset of cellular target iron-sulfur proteins such as ERCC2/XPD, FANCJ and RTEL1, thereby playing a key role in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription. As part of the mitotic spindle-associated MMXD complex, plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD. Indirectly acts as a transcriptional coactivator of estrogen receptor (ER), via its role in iron-sulfur insertion into some component of the TFIIH-machinery.

Specifications

• Accession Number: Q96T76
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64210
• Name: Human MMS19 (aa 447-530) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410001K24Rik; 2610042O15Rik; AI316855; C79368; C86341; hMMS19; homolog of yeast MMS19; incisor protein; MET18; MET18 homolog; Mms19; MMS19 (MET18 S. cerevisiae); MMS19 cytosolic iron-sulfur assembly component; MMS19 homolog, cytosolic iron-sulfur assembly component; MMS19 nucleotide excision repair homolog; MMS19 nucleotide excision repair homolog (S. cerevisiae); MMS19 nucleotide excision repair protein homolog; MMS19 nucleotide excision repair-like; Mms19l; MMS19-like (MET18 homolog, S. cerevisiae); MMS19-like protein
• Common Name: MMS19
• Gene Symbol: MMS19
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining