Invitrogen™ Human MOSC1 (aa 98-246) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90566	100 μL

Catalog No. RP90566 Supplier Invitrogen™ Supplier No. RP90566

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MOSC1 (MOCO sulphurase C-terminal domain containing 1), also known as MARC1, is a 337 amino acid mitochondrial protein that is thought to function as an oxidoreductase. Existing as three alternatively spliced isoforms, MOSC1 contains one MOSC domain and binds molybdenum as a cofactor. The gene encoding MOSC1 maps to human chromosome 1, which spans 260 million base pairs, contains over 3,000 genes and comprises nearly 8% of the human genome.

Specifications

• Accession Number: Q5VT66
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64757
• Name: Human MOSC1 (aa 98-246) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: mARC1; mitochondrial amidoxime reducing component 1; mitochondrial amidoxime-reducing component 1; moco sulfurase C-terminal domain-containing protein 1; MOCO sulphurase C-terminal domain containing 1; molybdenum cofactor sulfurase C-terminal domain-containing protein 1; MOSC domain-containing protein 1; MOSC domain-containing protein 1, mitochondrial; MOSC1
• Common Name: MOSC1
• Gene Symbol: MARC1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining