Invitrogen™ Human MPG (aa 165-282) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89471	100 μL

Catalog No. RP89471 Supplier Invitrogen™ Supplier No. RP89471

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82252. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.

Specifications

• Accession Number: P29372
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4350
• Name: Human MPG (aa 165-282) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on 16p; 3-alkyladenine DNA glycosylase; 3-methyladenine DNA glycosidase; 3-methyladenine DNA glycosylase; 9830006D05; AAG; ADPG; AI326268; alkylpurine-DNA-N-glycosylase; ANPG; APNG; CRA36.1; CRA36.1 (3-methyl-adenine DNA glycosylase); DNA-3-methyladenine glycosylase; MDG; Mid1; MPG; N-methylpurine DNA glycosylase; N-methylpurine-DNA glycocylase; N-methylpurine-DNA glycosylase; N-methylpurine-DNA glycosylase, MPG; PIG11; PIG16; proliferation-inducing protein 11; proliferation-inducing protein 16
• Common Name: MPG
• Gene Symbol: MPG
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining