Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human MPP10 (aa 457-550) Control Fragment Recombinant Protein

Catalog No. RP102647
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102647 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102647 Supplier Invitrogen™ Supplier No. RP102647
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57134. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MPP10 (M-phase phosphoprotein 10), also known as MPHOSPH10, is a 681 amino acid protein that localizes to the fibrillar region of the nucleolus. Phosphorylated in the M (mitotic) phase of the cell cycle, MPP10 is a component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex and is required for the early cleavages during pre-18S ribosomal RNA processing. MPP10 forms a heterotrimeric complex with IMP-3 and IMP-4, which may be required for its association with nucleolar components. The gene encoding MPP10 is localized to human chromosome 2, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00566
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10199
Name Human MPP10 (aa 457-550) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2810453H10Rik; 5730405D16Rik; AI326008; CT90; M phase phosphoprotein 10; M-phase phosphoprotein 10; M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein); Mphosph10; MPP10; MPP10P; PPP1R106; protein phosphatase 1, regulatory subunit 106; U3 small nucleolar ribonucleoprotein; U3 small nucleolar ribonucleoprotein protein MPP10
Common Name MPP10
Gene Symbol MPHOSPH10
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.