Invitrogen™ Human MPP5 (aa 567-643) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108493	100 μL

Catalog No. RP108493 Supplier Invitrogen™ Supplier No. RP108493

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MPP5 (Membrane Protein, Palmitoylated 5) plays a critical role in neurogenesis and hematopoiesis. This protein is crucial for establishing and maintaining cell polarity in epithelial cells and neurons. It is involved in the Par-3 complex, which contributes to maintaining tight junctions in epithelial cells. Mutations in MPP5 have been associated with severe neurologic impairments, including global developmental delay (GDD) and behavioral changes. In animal models, MPP5 is highly involved in the early differentiation of multipotent progenitors and supports long-term lineage-specific contributions, primarily in myeloid and lymphoid cells. MPP5 variants disrupt normal cellular function, leading to profound developmental and functional abnormalities.

Specifications

• Accession Number: Q8N3R9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64398
• Name: Human MPP5 (aa 567-643) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3830420B02Rik; AI255216; AI644496; FLJ12615; MAGUK p55 subfamily member 5; membrane palmitoylated protein 5; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 5); membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5); MPP5; palmitoylated 5; PALS1; protein associated with Lin Seven 1; protein associated with Lin-7 1; stardust
• Common Name: MPP5
• Gene Symbol: MPP5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining