Invitrogen™ Human MPP9 (aa 58-155) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97636	100 μL

Catalog No. RP97636 Supplier Invitrogen™ Supplier No. RP97636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Progression of cells from interphase to mitosis involves alterations in cell structures and activities. The transition from G2 to M phase is induced by M phase-promoting factor (MPF). In M phase, many proteins are phosphorylated directly by MPF or indirectly by kinases activated by MPF. These M phase phosphoproteins (MPPs), also known as MPHOSPHs, permit disassembly of interphase structures and generation of M phase enzymatic activities and structures. MPP9 (M-phase phosphoprotein 9), also known as MPHOSPH9, is a 1,031 amino acid peripheral membrane protein of the Golgi apparatus that exists as two alternatively spliced isoforms. The gene encoding MPP9 maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and trisomy 12p.

Specifications

• Accession Number: Q99550
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10198
• Name: Human MPP9 (aa 58-155) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930548D04Rik; 9630025B04Rik; AW413446; AW547060; B930097C17Rik; C87456; M-phase phosphoprotein 9; MPHOSPH9; MPP9; MPP-9
• Common Name: MPP9
• Gene Symbol: MPHOSPH9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining