Invitrogen™ Human mPR alpha (aa 1-72) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99833	100 μL

Catalog No. RP99833 Supplier Invitrogen™ Supplier No. RP99833

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The steroid progesterone induces the resumption of maturation in oocytes via a nongenomic pathway through binding to a novel, membrane progestin receptor (mPR). This pathway inhibits adenylyl cyclase and reduces intracellular cAMP, and also activates mitogen-activated protein kinase to effect signal transduction pathways. Three distinct groups, designated α, β and γ, comprise this gene family. mPRα, also designated progestin and adipoQ receptor family member VII (PAQR7), consists of an extracellular N-terminus, an intracellular C-terminus, and seven transmembrane domains. It is expressed in ovary, testis, placenta, uterus and bladder. mPRβ, also designated progestin and adipoQ receptor family member VIII (PAQR8), consists of eight putative transmembrane regions and an intracellular N-terminus that contains a leucine-rich motif. It is a 354 amino acid protein with a molecular mass of about 40 kDa and is expressed in brain and spinal cord. Both mPRα and mPRβ may be G protein-coupled receptors and may be involved in oocyte maturation.

Specifications

• Accession Number: Q86WK9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 164091
• Name: Human mPR alpha (aa 1-72) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310021M12Rik; AV001994; BB007237; Membrane progesterone P4 receptor alpha; Membrane progesterone receptor alpha; Membrane progestin receptor alpha; mPR; mPR alpha; Mpra; MRPA; mSR; PAQR7; Pglp; PPAR-gamma-induced liver protein; Progesterone and adipoQ receptor family member 7; Progestin and adipoQ receptor family member 7; progestin and adipoQ receptor family member VII
• Common Name: mPR alpha
• Gene Symbol: PAQR7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining