Invitrogen™ Human MRP7 (aa 1217-1280) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94746	100 μL

Catalog No. RP94746 Supplier Invitrogen™ Supplier No. RP94746

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59646. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MRP family is represented by nine similar ABC transporters that have the ability to transport structurally diverse lipophilic anions and operate as chemical efflux pumps. MRP7 (multidrug resistance-associated protein 7, ATPbinding cassette sub-family C member 10) is a multi-pass membrane protein that belongs to the ABC transporter family (conjugate transporter subfamily). MRP7 is involved with the ATP-dependent transport of 17β-estradiol-D-17-β-glucuronide (E217βG). MRP7 is also probably involved in cellular detoxification through its lipophilic anion extrusion capabilities. MRP7 contains two ABC transmembrane type 1 domains and two ABC transporter domains. MRP7 likely has three isoforms. Isoform 2 is the most widely expressed, while isoform 1 is predominately expressed in the spleen.

Specifications

• Accession Number: Q5T3U5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 89845
• Name: Human MRP7 (aa 1217-1280) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ABCC10; ATP binding cassette subfamily C member 10; ATP-binding cassette sub-family C member 10; ATP-binding cassette, subfamily C (CFTR/MRP), member 10; ATP-binding cassette, sub-family C (CFTR/MRP), member 10; EST182763; mFLJ00002; Mrp7; Multidrug resistance-associated protein 7; SIMRP7
• Common Name: MRP7
• Gene Symbol: ABCC10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining