Invitrogen™ Human MRPL28 (aa 7-95) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103222	100 μL

Catalog No. RP103222 Supplier Invitrogen™ Supplier No. RP103222

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MRP-L28 (39S ribosomal protein L28, melanoma-associated antigen recognized by T lymphocytes) is a mitochondrial protein that belongs to the ribosomal protein L28P family. MRP-L28 potentially represents an important therapeutic reagent for HLA-A24 (A24) patients as this antigen is recognized by tumor-infiltrating lymphocyte (TIL) 1290, which targets the A24 serotype. HLAA24 (A24) is an HLA-A serotype that identifies the more common HLA-A24 gene products. A24 is a split antigen that is also recognized by the A9 broad antigen type and the similar A23 types. A24 is common in Austronesia and has one of the highest A allele frequencies for a number of peoples, including Papua New Guineans, indigeonous Taiwanese (eastern tribals), Yupik and Greenland Eskimos. MRP-L28 is found in a variety of normal tissues including spleen, testis, thymus, liver, kidney, brain, adrenal, lung and retinal tissue.

Specifications

• Accession Number: Q13084
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10573
• Name: Human MRPL28 (aa 7-95) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110015G04Rik; 39S ribosomal protein L28, mitochondrial; HGNC6756; L28mt; MAAT 1; MAAT1; Melanoma antigen p15; melanoma-associated antigen recognised by cytotoxic T lymphocytes; melanoma-associated antigen recognized by T lymphocytes; melanoma-associated antigen recognized by T-lymphocytes; MGC8499; Mitochondrial large ribosomal subunit protein bL28m; mitochondrial ribosomal protein L28; MRP L28; MRPL 28; MRPL28; MRP-L28; p15
• Common Name: MRPL28
• Gene Symbol: MRPL28
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANND
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining