Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human MST3 (aa 374-438) Control Fragment Recombinant Protein

Catalog No. RP95236
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95236 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95236 Supplier Invitrogen™ Supplier No. RP95236
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK24 (MST3) is a serine/threonine kinase that is a member of the GCK subfamily of STE20-like proteins. The yeast 'Sterile 20' gene (STE20) functions upstream of the mitogen-activated protein kinase (MAPK) cascade. In mammals, protein kinases related to STE20 can be divided into 2 subfamilies based on their structure and regulation. Members of the PAK subfamily (see PAK3; MIM 300142) contain a C-terminal catalytic domain and an N-terminal regulatory domain that has a CDC42 (MIM 116952)-binding domain. In contrast, members of the GCK subfamily (see MAP4K2; MIM 603166), also called the Sps1 subfamily, have an N-terminal catalytic domain and a C-terminal regulatory domain without a CDC42-binding domain. STK24 belongs to the GCK subfamily of STE20-like kinases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6E0
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8428
Name Human MST3 (aa 374-438) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1810013H02Rik; C76483; epididymis secretory protein Li 95; HEL-S-95; Mammalian STE20-like protein kinase 3; Mammalian STE20-like protein kinase 3 C-terminal; Mammalian STE20-like protein kinase 3 N-terminal; mammalian sterile twenty 3 kinase; Mst3; MST-3; MST3/C; MST3/N; MST3B; OTTHUMP00000018594; RGD1561742; RP11-111L24.5; serine/threonine kinase 24; serine/threonine kinase 24 (STE20 homolog, yeast); serine/threonine-protein kinase 24; Serine/threonine-protein kinase 24 12 kDa subunit; Serine/threonine-protein kinase 24 35 kDa subunit; Serine/threonine-protein kinase 24 36 kDa subunit; STE20; STE20-like kinase 3; STE20-like kinase MST3; sterile 20-like kinase 3; STK24; STK3
Common Name MST3
Gene Symbol STK24
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.