Invitrogen™ Human MTG1 (aa 166-247) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104312	100 μL

Catalog No. RP104312 Supplier Invitrogen™ Supplier No. RP104312

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58127. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial GTPase. May be involved in assembly of the large ribosomal subunit.

Specifications

• Accession Number: Q9BT17
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 92170
• Name: Human MTG1 (aa 166-247) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Gm169; GTP; GTP binding protein 7 (putative); GTP-binding protein 7; GTP-binding protein 7 (putative); GTPBP7; Mitochondrial GTPase 1; mitochondrial GTPase 1 homolog; mitochondrial GTPase 1 homolog (S. cerevisiae); mitochondrial GTPase 1-like; mitochondrial ribosome associated GTPase 1; mitochondrial ribosome-associated GTPase 1; Mtg1; RP11-108K14.2
• Common Name: MTG1
• Gene Symbol: MTG1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining