Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human MTG16 (aa 95-135) Control Fragment Recombinant Protein

Catalog No. RP107162
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107162 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107162 Supplier Invitrogen™ Supplier No. RP107162
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66489. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(16;21)(q24;q22) translocation is one of the less common karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. This gene is also a putative breast tumor suppressor. Alternative splicing results in transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75081
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 863
Name Human MTG16 (aa 95-135) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias A630044F12Rik; AI465270; AW229127; CBFA2/RUNX1 partner transcriptional co-repressor 3; CBFA2/RUNX1 translocation partner 3; CBFA2T3; Cbfa2t3h; core-binding factor, runt domain, alpha subunit 2, translocated to, 3; core-binding factor, runt domain, alpha subunit 2, translocated to, 3 (human); core-binding factor, runt domain, alpha subunit 2; translocated to, 3; eight twenty one protein 2; ETO/MTG8-related protein ETO-2; Eto2; ETO-2; hMTG16; MTG16; MTG16HEL; MTG8-related gene 2; MTG8-related protein 2; MTGR2; myeloid translocation gene 8 and 16b; myeloid translocation gene on chromosome 16 protein; myeloid translocation gene-related protein 2; protein CBFA2T3; Protein ETO-2; RUNX1T3; translocated to, 3; zinc finger MYND domain-containing protein 4; ZMYND4
Common Name MTG16
Gene Symbol CBFA2T3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSFTPHTHREDGPATLPHGRFHGCLKWSMVCLLMNGSSHSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.