Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human MUC5AC Control Fragment Recombinant Protein

Catalog No. RP110191
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP110191 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP110191 Supplier Invitrogen™ Supplier No. RP110191
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The antibody 2-25LE reacts with Lewisb blood group antigen, a carbohydrate determinant carried on both glycolipids and glycoproteins, detected on erythrocytes, certain epithelial cells, and in secretions of certain individuals.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P98088
Concentration 1.5 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 4586
Name Human MUC5AC Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2210005L13Rik; gastric mucin; LeB; lewis B blood group antigen; LOW QUALITY PROTEIN: mucin-5AC; major airway glycoprotein; MGM; MUC5; MUC5AC; MUC-5AC; mucin; mucin 5, subtypes A and C; mucin 5, subtypes A and C, tracheobronchial/gastric; mucin 5ac; mucin 5AC, oligomeric mucus/gel-forming; mucin 5AC, oligomeric mucus/gel-forming pseudogene; mucin-5 subtype AC, tracheobronchial; Mucin-5AC; TBM; Tracheobronchial mucin
Common Name MUC5AC
Gene Symbol MUC5AC
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.