Invitrogen™ Human MXRA5 (aa 395-494) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109560	100 μL

Catalog No. RP109560 Supplier Invitrogen™ Supplier No. RP109560

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Matrix-remodeling-associated protein 5 (MXRA5), also known as adhesion protein with leucine-rich repeats and immunoglobulin domains related to perlecan (Adlican), is a 2,828 amino acid secretory protein. Containing 12 Ig-like C2-type domains and 7 LRR repeats, MXRA5 is a member of the leucine-rich repeat and Ig domain-containing (LRRIG) family of proteins. MXRA5 expression, while decreasing with age from youth until late adulthood, increases from late adulthood through late elderhood. Most notably, NXRA5 has been shown to be overexpressed in centenarians. This expression pattern suggests a role of MXRA5 in the biology of aging and longevity.

Specifications

• Accession Number: Q9NR99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 25878
• Name: Human MXRA5 (aa 395-494) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Adhesion protein with leucine-rich repeats and immunoglobulin domains related to perlecan; adlican; matrix remodeling associated 5; matrix-remodeling-associated protein 5; matrix-remodelling associated 5; MXRA5
• Common Name: MXRA5
• Gene Symbol: MXRA5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMLSKDPRVSYQYRQDADEEALYYTGVRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTISTKDTRQARGRSWVMIEPSGAVQRDQTVLEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining