Invitrogen™ Human MYCBP (aa 31-82) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99843	100 μL

Catalog No. RP99843 Supplier Invitrogen™ Supplier No. RP99843

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59476. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.

Specifications

• Accession Number: Q99417
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26292
• Name: Human MYCBP (aa 31-82) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730488M09Rik; Amy1; AMY-1; Associate of Myc 1; associate of myc-1; AW552132; AW742590; c-myc binding protein; C-Myc-binding protein; hypothetical protein LOC539291; LOW QUALITY PROTEIN: C-Myc-binding protein; MYC binding protein; MYCBP
• Common Name: MYCBP
• Gene Symbol: MYCBP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining