Invitrogen™ Human MYH3 (aa 25-94) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93219	100 μL

Catalog No. RP93219 Supplier Invitrogen™ Supplier No. RP93219

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54514. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Muscle contraction.

Specifications

• Accession Number: P11055
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4621
• Name: Human MYH3 (aa 25-94) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DA2A; DA2B; DA8; embryonic skeletal myosin heavy chain isoform; HEMHC; Muscle embryonic myosin heavy chain; MYH3; MyHC-emb; Myhse; Myhs-e; MYHSE1; myosin heavy chain 3; Myosin heavy chain, fast skeletal muscle, embryonic; myosin heavy polypeptide 3; myosin, heavy chain 3, skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic; myosin, skeletal, heavy chain, embryonic 1; myosin-3; RNMHCG; SMHCE
• Common Name: MYH3
• Gene Symbol: MYH3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining