Invitrogen™ Human MYL2 (aa 75-163) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89522	100 μL

Catalog No. RP89522 Supplier Invitrogen™ Supplier No. RP89522

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thus gene encodes the regulatory light chain associated with cardiac myosin beta heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Specifications

• Accession Number: P10916
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4633
• Name: Human MYL2 (aa 75-163) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: cardiac myosin light chain 2; cardiac myosin light chain-2; cardiac ventricular myosin light chain 2; CMH10; DKFZp779C0562; hypothetical protein LOC677750; Mlc2; MLC-2; mlc2b; MLC-2s/v; MLC2V; MLC-2v; myl2; myl2b; Mylpc; myosin light chain 2; myosin light chain 2, slow skeletal/ventricular muscle isoform; myosin light chain 2V; myosin light chain phosphatase; myosin light chain, phosphorylatable, cardiac ventricles; myosin light chain-2; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; myosin regulatory light chain 2b; myosin regulatory light chain ventricular isoform; myosin, light chain 2, regulatory, cardiac, slow; myosin, light chain 2b, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin, light polypeptide 2b, regulatory, cardiac, slow; regulatory light chain of myosin; RLC of myosin; slow cardiac myosin regulatory light chain 2; ventricular myosin light chain 2; ventricular myosin regulatory light chain; zgc:136848
• Common Name: MYL2
• Gene Symbol: MYL2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining