Invitrogen™ Human MYL3 (aa 5-69) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91305	100 μL

Catalog No. RP91305 Supplier Invitrogen™ Supplier No. RP91305

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82553. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy.

Specifications

• Accession Number: P08590
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4634
• Name: Human MYL3 (aa 5-69) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cardiac myosin light chain 1; CMH8; CMLC1; MLC1s; MLC1SB; Mlc1v; MLClV; MLC-lV/sb; MYL3; Mylc; Mylc1v; Myosin alkali light chain 1, ventricular; Myosin alkali light chain 1, ventricular/slow skeletal muscle isoform; Myosin light chain 1, slow-twitch muscle B/ventricular isoform; myosin light chain 3; Myosin light chain 3, alkali, cardiac ventricles; myosin light chain, alkali, cardiac ventricles; myosin, light chain 3, alkali; ventricular, skeletal, slow; myosin, light polypeptide 3; myosin, light polypeptide 3, alkali; ventricular, skeletal, slow; rVMLC1; slow skeletal; slow skeletal ventricular myosin alkali light chain 3; ventricular; ventricular myosin alkali light chain; Ventricular myosin light chain 1; ventricular, skeletal, slow; ventricular/slow twitch myosin alkali light chain; VLC1; VLCl
• Common Name: MYL3
• Gene Symbol: MYL3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining