Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human MYOZ2 (aa 44-115) Control Fragment Recombinant Protein

Catalog No. RP96741
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96741 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96741 Supplier Invitrogen™ Supplier No. RP96741
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57390. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calcineurin-binding protein Myozenin 2, also designated calsarcin-1, is a member of the calsarcin protein family. Calcineurin is a calcium- and calmodulin-dependent protein phosphatase that is involved in controlling the slow fiber gene expression in skeletal muscle and hypertrophy of cardiac muscle. The calsarcins are sarcomeric proteins that couple calcineurin and muscle activity. In cardiac and skeletal muscle cells, Myozenin 2 binds calcineurin to α-actinin at the Z-line of the sarcomere. During embryogenesis, Myozenin 1 and 2 are expressed in developing muscle. The Myozenin 2 gene maps to chromosome 4q and is expressed specifically in adult cardiac and slow-twitch skeletal muscle, while Myozenin 1 is only detected in fast skeletal muscle.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NPC6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 51778
Name Human MYOZ2 (aa 44-115) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1110012I24Rik; C4orf5; calcineurin-binding protein calsarcin-1; calsarcin-1; CMH16; CS-1; Fatz-2; FATZ-related protein 2; muscle-specific protein; myoz2; myozenin 2; myozenin-2; myozenin-like 2; Myozl2
Common Name MYOZ2
Gene Symbol MYOZ2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.