Invitrogen™ Human N4BP1 (aa 419-517) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98671	100 μL

Catalog No. RP98671 Supplier Invitrogen™ Supplier No. RP98671

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nedd4-binding partner-1 (N4BP1) is a developmentally expressed protein interactor and monoubiquitylation substrate of Nedd4, a HECT domain-containing ubiquitin ligase that mediates ubiquitylation and proteasome degradation of target proteins and may have a fundamental role to play in embryonic processes. N4BP1 can undergo Nedd4-mediated polyubiquitylation and proteosomal degradation. N4BP1 also functions as a negative regulator of AIF4 (also known as ITCH or Atrophin-1), an E3-ubiquitin ligase, by interacting with the second WW domain of AIF4 and impairing ubiquitination of substrates.

Specifications

• Accession Number: O75113
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9683
• Name: Human N4BP1 (aa 419-517) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI481586; C81621; Kiaa0615; N4BP1; Nedd4 binding protein 1; NEDD4-binding protein 1; RGD1305179
• Common Name: N4BP1
• Gene Symbol: N4BP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NELTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining