Invitrogen™ Human NAA20 (aa 92-165) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107229	100 μL

Catalog No. RP107229 Supplier Invitrogen™ Supplier No. RP107229

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.

Specifications

• Accession Number: P61599
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51126
• Name: Human NAA20 (aa 92-165) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1500004D14Rik; 2900026I01Rik; AU041458; D2Ertd186e; dJ1002M8.1; Methionine N-acetyltransferase; N(alpha)-acetyltransferase 20, NatB catalytic subunit; NAA20; N-acetyltransferase 3 homolog; N-acetyltransferase 5; N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae); N-acetyltransferase 5 (GCN5-related, putative); N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog); N-alpha-acetyltransferase 20; N-alpha-acetyltransferase 20, NatB catalytic subunit; NAT3; NAT3P; NAT5; NAT5P; NatB catalytic subunit; natB complex subunit NAT5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-terminal acetyltransferase B complex catalytic subunit NAT5; N-terminal acetyltransferase complex ARD1 subunit
• Common Name: NAA20
• Gene Symbol: NAA20
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining