Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human NALP11 (aa 928-1030) Control Fragment Recombinant Protein

Catalog No. RP99200
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99200 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99200 Supplier Invitrogen™ Supplier No. RP99200
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61235. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP11 is a 1033 amino acid containing cytoplasmic protein belonging to the NLRP family with a DAPIN domain, six LRR (leucine-rich) repeats and a NACHT domain. Reports suggest that it is a short NALP involved in inflammation potential. NALP proteinsare implicated in the activation of proinflammatory caspases (e.g., CASP1) via their involvement in multiprotein complexes called inflammasomes. The DAPIN domain is necessary and sufficient for suppression of NF-kappa B activation induced by TNF and for inducing IL-1B secretion in collaboration with Caspase-1. It is involved in interaction with PYCARD.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P59045
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 204801
Name Human NALP11 (aa 928-1030) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias CLR19.6; NACHT, leucine rich repeat and PYD containing 11; NACHT, LRR and PYD domains-containing protein 11; NALP11; NLR family pyrin domain containing 11; NLR family, pyrin domain containing 11; NLRP11; NOD17; Nucleotide-binding oligomerization domain protein 17; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 11; PAAD- and NACHT-containing protein 10B; PAAD-and NACHT domain-containing protein 10; PAN10; PYPAF6; PYPAF7; PYRIN-containing APAF1-like protein 6
Common Name NALP11
Gene Symbol NLRP11
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.