Invitrogen™ Human NASP (aa 657-752) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94204	100 μL

Catalog No. RP94204 Supplier Invitrogen™ Supplier No. RP94204

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56493. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NASP encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localized to the nucleus, and is coupled to the cell cycle. The testicular form is expressed in embryonic tissues, tumor cells, and the testis. In male germ cells, this protein is localized to the cytoplasm of primary spermatocytes, the nucleus of spermatids, and the periacrosomal region of mature spermatozoa.

Specifications

• Accession Number: P49321
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4678
• Name: Human NASP (aa 657-752) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5033430J04Rik; AI131596; AI317140; D4Ertd767e; DKFZp547F162; EMBL:AAH81913.1}; Epcs32; FLB7527; FLJ31599; FLJ35510; histone H1-binding protein; HMDRA1; MGC19722; MGC20372; MGC2297; Nasp; nasp {ECO:0000312; NASP histone chaperone; nasp protein; Nasp-T; Nuclear autoantigenic sperm protein; nuclear autoantigenic sperm protein (histone-binding); PRO1999; somatic histone binding protein NASP; wu:fd20g12; zgc:56007; zgc:85651
• Common Name: NASP
• Gene Symbol: NASP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining