Invitrogen™ Human NAV3 (aa 898-982) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56931 (PA5-56931. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neuron navigator 3 (NAV3), also known as pore membrane and/or filamentinteracting-like protein 1 (POMFIL1), unc-53 homolog 3 (unc53H3) or STEERIN3, is a 2,385 amino acid protein that localizes to the nuclear outer membrane and plays a role in neuron regeneration. Existing as three alternatively spliced isoforms, Neuron navigator 3 is highly expressed in adult and fetal brain and is found at moderate to low levels in ovary, lung, testis, placenta and heart. Neuron navigator 3 is thought be involved in the regulation of IL-2 production and contains one CH (calponin-homology) domain, three N-terminal hydrophobic domains, multiple N-glycosylation sites, three ATP/GTP-binding A motifs (P loops) and several phosphorylation sites.

Specifications

• Accession Number: Q8IVL0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 89795
• Name: Human NAV3 (aa 898-982) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732483H20Rik; 9630020C08Rik; KIAA0938; mKIAA0938; NAV3; Neuron navigator 3; POMFIL1; Pomfil1p; pore membrane and/or filament interacting like protein 1; pore membrane and/or filament-interacting-like protein 1; RGD1306259; steerin 3; STEERIN3; Steerin-3; Unc-53 homolog 3; unc53H3
• Common Name: NAV3
• Gene Symbol: NAV3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining