Invitrogen™ Human NCAPH2 (aa 113-200) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103867	100 μL

Catalog No. RP103867 Supplier Invitrogen™ Supplier No. RP103867

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64393. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Structural maintenance of chromosomes (SMC) and non-SMC condensin proteins associate into complexes that have been implicated in the process of chromosome condensation. A crucial prerequisite for accurate segregation of replicated sister chromatids is the condensation of the chromosomes into a manageable form prior to metaphase. The condensin I complex consists of two SMC subunits, SMC2 and SMC4, and three non-SMC subunits, CAP-H, CAP-G, and CAP-D2. An alternative complex, the condensin II complex, contains alternate non-SMC subunits, CAP-G2, CAP-H2, and CAP-D3. CAP-H2 is also known as Non-SMC condensin II complex, subunit H2 (NCAPH2) or kleisin beta isoform 2. The three non-SMC subunits in the condensing complexes form a regulatory subcomplex that is required to activate the SMC ATPases and to promote mitosis-specific chromatin binding of the holocomplex. The precise individual functions of each non-SMC protein in activation remain to be determined.

Specifications

• Accession Number: Q6IBW4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29781
• Name: Human NCAPH2 (aa 113-200) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CAPH2; CAP-H2 subunit of the condensin II complex; Chromosome-associated protein H2; condensin-2 complex subunit H2; CTA-384D8.36; D15Ertd785e; hCAP-H2; kleisin beta; Kleisin-beta; Ncaph2; Non-SMC condensin II complex subunit H2; non-SMC condensin II complex, subunit H2
• Common Name: NCAPH2
• Gene Symbol: NCAPH2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining