Invitrogen™ Human NDUFA8 (aa 2-79) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98408	100 μL

Catalog No. RP98408 Supplier Invitrogen™ Supplier No. RP98408

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59642. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFA8 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Mammalian complex I is composed of 45 different subunits and transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Specifications

• Accession Number: P51970
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4702
• Name: Human NDUFA8 (aa 2-79) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610033L03Rik; Aa2-258; AW261656; CI-19KD; CI-PGIV; Complex I-19kD; complex I-PGIV; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8; NADH:ubiquinone oxidoreductase PGIV subunit; NADH:ubiquinone oxidoreductase subunit A8; NADH-ubiquinone oxidoreductase 19 kDa subunit; NDUFA8; PGIV
• Common Name: NDUFA8
• Gene Symbol: NDUFA8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining