Invitrogen™ Human NDUFA9 (aa 153-228) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105577	100 μL

Catalog No. RP105577 Supplier Invitrogen™ Supplier No. RP105577

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFA9 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial) is also named as NDUFS2L, CI-39kD and belongs to the complex I NDUFA9 subunit family. It is involved in stabilizing the junction between membrane and matrix arms of complex I, a late assembly step critical for complex I biogenesis and activity.

Specifications

• Accession Number: Q16795
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4704
• Name: Human NDUFA9 (aa 153-228) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1010001N11Rik; CC6; CI39k; CI-39k; CI-39kD; complex I 39kDa subunit; complex I-39kD; EMBL:AAH91192.1, ECO:0000312; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 42 kDa subunit; NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; NADH:ubiquinone oxidoreductase subunit A9; NADH-ubiquinone oxidoreductase 39 kDa subunit; NDUFA9; ndufa9 {ECO:0000312; NDUFS2L; RGD:1307307}; SDR22E1; short chain dehydrogenase/reductase family 22E, member 1; sperm flagella protein 3
• Common Name: NDUFA9
• Gene Symbol: NDUFA9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining